Anti-GRK2 / Beta-adrenergic receptor kinase 1

Anti-GRK2 / Beta-adrenergic receptor kinase 1
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-RQ4087 100 µg - -

3 - 10 business days*

772.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Beta adrenergic receptor kinase (also... more
Product information "Anti-GRK2 / Beta-adrenergic receptor kinase 1"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Beta adrenergic receptor kinase (also referred to as beta-ARK or BARK) is a serine/threonine intracellular kinase. The product of this gene phosphorylates the beta-2-adrenergic receptor and appears to mediate agonist-specific desensitization observed at high agonist concentrations. This protein is an ubiquitous cytosolic enzyme that specifically phosphorylates the activated form of the beta-adrenergic and related G-protein-coupled receptors. Abnormal coupling of beta-adrenergic receptor to G protein is involved in the pathogenesis of the failing heart. Protein function: Specifically phosphorylates the agonist-occupied form of the beta-adrenergic and closely related receptors, probably inducing a desensitization of them. Key regulator of LPAR1 signaling. Competes with RALA for binding to LPAR1 thus affecting the signaling properties of the receptor. Desensitizes LPAR1 and LPAR2 in a phosphorylation-independent manner. [The UniProt Consortium]
Keywords: Anti-ADRBK1, Anti-Beta-ARK-1, Anti-Beta-adrenergic receptor kinase 1, Anti-G-protein coupled receptor kinase 2, GRK2 Antibody / Beta-adrenergic receptor kinase 1
Supplier: NSJ Bioreagents
Supplier-Nr: RQ4087

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: mouse, rat
Immunogen: Amino acids DSDPELVQWKKELRDAYREAQQLVQRVPKMKNK from the human protein were used as the immunogen for the GRK2 antibody.
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-GRK2 / Beta-adrenergic receptor kinase 1"
Write a review
or to review a product.
Viewed