Anti-GPNMB

Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG10645.50 50 µl - -

6 - 14 business days*

520.00€
 
Protein function: Could be a melanogenic enzyme. [The UniProt Consortium] more
Product information "Anti-GPNMB"
Protein function: Could be a melanogenic enzyme. [The UniProt Consortium]
Keywords: Anti-GPNMB, Anti-HGFIN, Anti-Transmembrane glycoprotein NMB, Anti-Transmembrane glycoprotein HGFIN
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG10645

Properties

Application: IHC (paraffin), WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human (Expected: cow, dog, guinea pig, horse, mouse, rabbit, rat)
Immunogen: Synthetic peptide around the N-terminus of Human GPNMB. (DENDWNEKLYPVWKRGDMRWKNSWKGGRVQAVLTSDSPALVGSNITFAVN)
MW: 63 kD
Format: Antigen Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-GPNMB"
Write a review
or to review a product.
Viewed