Anti-GPI / Glucose-6-phosphate isomerase

Anti-GPI / Glucose-6-phosphate isomerase
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32536 100 µg - -

3 - 10 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Glucose-6-phosphate isomerase (GPI),... more
Product information "Anti-GPI / Glucose-6-phosphate isomerase"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Glucose-6-phosphate isomerase (GPI), alternatively known as phosphoglucose isomerase (PGI) or phosphohexose isomerase(PHI), is an enzyme that in humans is encoded by the GPI gene on chromosome 19. This gene encodes a member of the glucose phosphate isomerase protein family. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. In the cytoplasm, the gene product functions as a glycolytic enzyme (glucose-6-phosphate isomerase) that interconverts glucose-6-phophsate and fructose-6-phosphate. Extracellularly, the encoded protein (also referred to as neuroleukin) functions as a neurotrophic factor that promotes survival of skeletal motor neurons and sensory neurons, and as a lymphokine that induces immunoglobulin secretion. The encoded protein is also referred to as autocrine motility factor based on an additional function as a tumor-secreted cytokine and angiogenic factor. Defects in this gene are the cause of nonspherocytic hemolytic anemia and a severe enzyme deficiency can be associated with hydrops fetalis, immediate neonatal death and neurological impairment. Alternative splicing results in multiple transcript variants. Protein function: Besides it's role as a glycolytic enzyme, mammalian GPI can function as a tumor-secreted cytokine and an angiogenic factor (AMF) that stimulates endothelial cell motility. GPI is also a neurotrophic factor (Neuroleukin) for spinal and sensory neurons. [The UniProt Consortium]
Keywords: Anti-PHI, Anti-GPI, Anti-NLK, Anti-AMF, Anti-PGI, Anti-SA-36, EC=5.3.1.9, Anti-Neuroleukin, Anti-Sperm antigen 36, Anti-Phosphohexose isomerase, Anti-Phosphoglucose isomerase, Anti-Autocrine motility factor, Anti-Glucose-6-phosphate isomerase, GPI Antibod
Supplier: NSJ Bioreagents
Supplier-Nr: R32536

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human
Immunogen: Amino acids 5-39 (TRDPQFQKLQQWYREHRSELNLRRLFDANKDRFNH) from the human protein
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-GPI / Glucose-6-phosphate isomerase"
Write a review
or to review a product.
Viewed