Anti-GNGT2

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG58936.50	50 µl		-	-	10 - 15 business days*		584.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or... more

Close menu

Product information "Anti-GNGT2"

Protein function: Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein- effector interaction. [The UniProt Consortium]

Keywords:	Anti-GNG8, Anti-GNGT2, Anti-G-gamma-8, Anti-G-gamma-9, Anti-G gamma-C, Anti-Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-T2, Anti-Guanine nucleotide binding protein gamma transducing activity polypeptide 2
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG58936

Properties

Application:	WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human (Expected: mouse, rat, bovine, dog, guinea pig, horse, rabbit, sheep)
Immunogen:	Synthetic peptide around the middle region of Human GNGT2. (within the following region: KEVKNTRIPISKAGKEIKEYVEAQAGNDPFLKGIPEDKNPFKEKGGCLIS)
MW:	7 kD
Format:	Affinity Purified