Anti-GNG11 (Guanine Nucleotide Binding Protein (G Protein), gamma 11, GNGT11)

Anti-GNG11 (Guanine Nucleotide Binding Protein (G Protein), gamma 11, GNGT11)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
246674.50 50 µg - -

3 - 19 business days*

850.00€
 
This gene is a member of the guanine nucleotide-binding protein (G protein) gamma family and... more
Product information "Anti-GNG11 (Guanine Nucleotide Binding Protein (G Protein), gamma 11, GNGT11)"
This gene is a member of the guanine nucleotide-binding protein (G protein) gamma family and encodes a lipid-anchored, cell membrane protein. As a member of the heterotrimeric G protein complex, this protein plays a role in this transmembrane signaling system. This protein is also subject to carboxyl-terminal processing. Decreased expression of this gene is associated with splenic marginal zone lymphomas. [provided by RefSeq, Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MPALHIEDLPEKEKLKMEVEQLRKEVKLQRQQVSKCSEEIKNYIEERSGEDPLVKGIPEDKNPFKEKGSCVIS, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Supplier: United States Biological
Supplier-Nr: 246674

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Mouse
Species reactivity: human
Immunogen: GNG11 (AAH09709.1, 1aa-73aa) full-length human protein.
Format: Purified

Database Information

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-GNG11 (Guanine Nucleotide Binding Protein (G Protein), gamma 11, GNGT11)"
Write a review
or to review a product.
Viewed