Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
| Item number | Size | Datasheet | Manual | SDS | Delivery time | Quantity | Price |
|---|---|---|---|---|---|---|---|
| ARG43266.50 | 50 µl | - | - |
6 - 14 business days* |
592.00€
|
If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
Protein function: Guanine nucleotide-binding proteins (G proteins) function as transducers in... more
Product information "Anti-GNAS2 / GNASs"
Protein function: Guanine nucleotide-binding proteins (G proteins) function as transducers in numerous signaling pathways controlled by G protein- coupled receptors (GPCRs). Signaling involves the activation of adenylyl cyclases, resulting in increased levels of the signaling molecule cAMP. GNAS functions downstream of several GPCRs, including beta-adrenergic receptors. XLas isoforms interact with the same set of receptors as GNAS isoforms. [The UniProt Consortium]
| Keywords: | Anti-GNAS, Anti-XLalphas, Anti-XLalphas, Anti-Extra large alphas protein, Anti-Extra large alphas protein, Anti-Adenylate cyclase-stimulating G alpha protein, Anti-Adenylate cyclase-stimulating G alpha protein, Anti-Guanine nucleotide-binding protein G(s) |
| Supplier: | Arigo Biolaboratories |
| Supplier-Nr: | ARG43266 |
Properties
| Application: | IHC (paraffin), WB |
| Antibody Type: | Polyclonal |
| Conjugate: | No |
| Host: | Rabbit |
| Species reactivity: | human, mouse (Expected: bovine, rat, swine, rabbit) |
| Immunogen: | Synthetic peptide around the N-terminal region of Human GNAS2 / GNASs. (within the following region: SGKSTIVKQMRILHVNGFNGDSEKATKVQDIKNNLKEAIETIVAAMSNLV) |
| MW: | 44 kD |
| Format: | Purified |
Database Information
| UniProt ID : | Q5JWF2 | Matching products |
| Gene ID : | GeneID 2778 | Matching products |
Handling & Safety
| Storage: | -20°C |
| Shipping: | +4°C (International: °C) |
Caution
Our products are for laboratory research use only: Not for administration to humans!
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow.
more
You will get a certificate here
Viewed