Anti-GM2A

Anti-GM2A
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG58933.50 50 µl - -

10 - 15 business days*

584.00€
 
Protein function: The large binding pocket can accommodate several single chain phospholipids and... more
Product information "Anti-GM2A"
Protein function: The large binding pocket can accommodate several single chain phospholipids and fatty acids, GM2A also exhibits some calcium-independent phospholipase activity. Binds gangliosides and stimulates ganglioside GM2 degradation. It stimulates only the breakdown of ganglioside GM2 and glycolipid GA2 by beta-hexosaminidase A. It extracts single GM2 molecules from membranes and presents them in soluble form to beta- hexosaminidase A for cleavage of N-acetyl-D-galactosamine and conversion to GM3. [The UniProt Consortium]
Keywords: Anti-GM2A
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG58933

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human (Expected: guinea pig)
Immunogen: Synthetic peptide around the N-terminal region of Human GM2A. (within the following region: SWDNCDEGKDPAVIRSLTLEPDPIIVPGNVTLSVMGSTSVPLSSPLKVDL)
MW: 20 kD
Format: Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-GM2A"
Write a review
or to review a product.
Viewed