Anti-Glypican 3 (Glypican-3, GPC3, DGSX, GTR2-2, Intestinal Protein OCI-5, MXR7, OCI5, OCI-5, SDYS,

Anti-Glypican 3 (Glypican-3, GPC3, DGSX, GTR2-2, Intestinal Protein OCI-5, MXR7, OCI5, OCI-5, SDYS,
Item number Size Datasheet Manual SDS Delivery time Quantity Price
127389.200 200 µl - -

3 - 19 business days*

866.00€
 
GPC3 is a cell surface proteoglycan that bears heparan sulfate. This protein may be involved in... more
Product information "Anti-Glypican 3 (Glypican-3, GPC3, DGSX, GTR2-2, Intestinal Protein OCI-5, MXR7, OCI5, OCI-5, SDYS,"
GPC3 is a cell surface proteoglycan that bears heparan sulfate. This protein may be involved in the suppression/modulation of growth in the predominantly mesodermal tissues and organs, and may play a role in the modulation of IGF2 interactions with its receptor and thereby modulate its function. Members of the glypican-related integral membrane proteoglycan family contain a core protein anchored to the cytoplasmic membrane via a glycosyl phosphatidylinositol (GPI) linkage. These proteins may play a role in the control of cell division, growth regulation, and tumor predisposition. Deletion mutations in GPC3 are the cause of Simpson-Golabi-Behmel syndrome (SGBS), also known as Simpson dysmorphia syndrome (SDYS). SGBS is a condition characterized by pre- and postnatal overgrowth (gigantism) with visceral and skeletal anomalies. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: HAKNYTNAMFKNNYPSLTPQAFEFVGEFFTDVSLYILGSDINVDDMVNELFDSLFPVIYTQLMNPGLPDSALDINECLRGARRDLKVFGNFPKLIMTQVS, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Supplier: United States Biological
Supplier-Nr: 127389

Properties

Application: ELISA, WB
Antibody Type: Monoclonal
Clone: 2C12
Conjugate: No
Host: Mouse
Species reactivity: human
Format: Ascites

Database Information

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-Glypican 3 (Glypican-3, GPC3, DGSX, GTR2-2, Intestinal Protein OCI-5, MXR7, OCI5, OCI-5, SDYS,"
Write a review
or to review a product.
Viewed