Anti-GluR1 (Glutamate Receptor 1, GluR-1, AMPA-selective Glutamate Receptor 1, GLUH1, GLURA, GluR-A,

Glutamate receptors (GluRs) are the most important mediators of excitatory signal transduction in the central nervous system. They can be pharmacologically classified in three distinct classes: alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid (AMPA) receptors, kainate (KA) receptors, and N-methyl-D-aspartate (NMDA) receptors. The AMPA-type glutamate receptor opens in response to glutamate binding, and mediates most of the rapid excitatory postsynaptic current. The activation of AMPA receptors leads to stimulation of a multitude of biochemical pathways in postsynaptic neurones eventually leading to postsynaptic neuronal plasticity. GluR1 belongs to the family of alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate (AMPA) receptors. GluR1 gene is located on human chromosome 5q33 and is expressed granule and pyramidal cells in the hippocampal formation. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: VVDCESERLNAILGQIIKLEKNGIGYHYILANLGFMDIDLNKFKESGANVTGFQLVNYTDTIPAKIMQQWKNSDARDHTRVDWKRPKYTSALTYDGVKVM, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.