Anti-GJC1 / Connexin 45

Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG59205.50 50 µg - -

6 - 14 business days*

551.00€
 
Protein function: One gap junction consists of a cluster of closely packed pairs of transmembrane... more
Product information "Anti-GJC1 / Connexin 45"
Protein function: One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell. [The UniProt Consortium]
Keywords: Anti-GJC1, Anti-GJA7, Anti-Cx45, Anti-Connexin-45, Anti-Gap junction alpha-7 protein, Anti-Gap junction gamma-1 protein
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG59205

Properties

Application: IHC (paraffin)
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Synthetic peptide corresponding to aa. 91-131 of Human GJC1 / Connexin 45. (YLGYAIHKIAKMEHGEADKKAARSKPYAMRWKQHRALEETE)
MW: 45 kD
Format: Antigen Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-GJC1 / Connexin 45"
Write a review
or to review a product.
Viewed