Anti-GJC1 / Connexin 45

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG59205.50	50 µg		-	-	6 - 14 business days*		520.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: One gap junction consists of a cluster of closely packed pairs of transmembrane... more

Close menu

Product information "Anti-GJC1 / Connexin 45"

Protein function: One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell. [The UniProt Consortium]

Keywords:	Anti-GJC1, Anti-GJA7, Anti-Cx45, Anti-Connexin-45, Anti-Gap junction alpha-7 protein, Anti-Gap junction gamma-1 protein
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG59205

Properties

Application:	IHC (paraffin)
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human, mouse, rat
Immunogen:	Synthetic peptide corresponding to aa. 91-131 of Human GJC1 / Connexin 45. (YLGYAIHKIAKMEHGEADKKAARSKPYAMRWKQHRALEETE)
MW:	45 kD
Format:	Antigen Affinity Purified