Anti-GJB1 (Gap Junction beta-1 Protein, Connexin-32, Cx32, GAP Junction 28 kDa Liver Protein, CX32)

Anti-GJB1 (Gap Junction beta-1 Protein, Connexin-32, Cx32, GAP Junction 28 kDa Liver Protein, CX32)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
127325.100 100 µg - -

9 - 20 business days*

850.00€
 
One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the... more
Product information "Anti-GJB1 (Gap Junction beta-1 Protein, Connexin-32, Cx32, GAP Junction 28 kDa Liver Protein, CX32)"
One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: RLWSLQLILVSTPALLVAMHVAHQQHIEKKMLRLEGHGDPLHLEEVKRHKVHISGTLWWTYVISVVFRLLFEAVFMYVFYLLYPGYAMVRLVKCDVYPCP, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Supplier: United States Biological
Supplier-Nr: 127325

Properties

Application: ELISA
Antibody Type: Monoclonal
Clone: 1F5
Conjugate: No
Host: Mouse
Species reactivity: human
Immunogen: Partial recombinant corresponding to aa75-174 from human GJB1 (AAH22426) with GST tag. MW of the GST tag alone is 26kD.
Purity: Purified by Protein A affinity chromatography.
Format: Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-GJB1 (Gap Junction beta-1 Protein, Connexin-32, Cx32, GAP Junction 28 kDa Liver Protein, CX32)"
Write a review
or to review a product.
Viewed