Anti-GJA3 / Connexin 46

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG58825.50	50 µg		-	-	6 - 14 business days*		520.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: Structural component of lens fiber gap junctions (PubMed:30044662). Gap... more

Close menu

Product information "Anti-GJA3 / Connexin 46"

Protein function: Structural component of lens fiber gap junctions (PubMed:30044662). Gap junctions are dodecameric channels that connect the cytoplasm of adjoining cells. They are formed by the docking of two hexameric hemichannels, one from each cell membrane. Small molecules and ions diffuse from one cell to a neighboring cell via the central pore (PubMed:30044662). [The UniProt Consortium]

Keywords:	Anti-Cx46, Anti-GJA3, Anti-Connexin-46, Anti-Gap junction alpha-3 protein
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG58825

Properties

Application:	WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human, mouse, rat
Immunogen:	Synthetic peptide corresponding to aa. 89-118 of Human GJA3 (TLIYLGHVLHIVRMEEKKKEREEEEQLKRE)
MW:	47 kD
Format:	Antigen Affinity Purified