Anti-GATA2

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG41643.50	50 µl		-	-	6 - 14 business days*		551.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: Transcriptional activator which regulates endothelin-1 gene expression in... more

Close menu

Product information "Anti-GATA2"

Protein function: Transcriptional activator which regulates endothelin-1 gene expression in endothelial cells. Binds to the consensus sequence 5'-AGATAG-3'. [The UniProt Consortium]

Keywords:	Anti-GATA2, Anti-GATA-binding protein 2, Anti-Endothelial transcription factor GATA-2
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG41643

Properties

Application:	ChIP, WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human, mouse (Expected: cow, rat, dog, guinea pig, horse, rabbit)
Immunogen:	Synthetic peptide around the N-terminal region of Human GATA2. (within the following region: PYYANPAHARARVSYSPAHARLTGGQMCRPHLLHSPGLPWLDGGKAALSA)
MW:	505 kD
Format:	Purified