Anti-GAT-1 / GABA Transporter 1 / SLC6A1 (N-Terminal Region)

Anti-GAT-1 / GABA Transporter 1 / SLC6A1 (N-Terminal Region)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32967 100 µg - -

3 - 10 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. GABA transporter 1 (GAT1), also known as... more
Product information "Anti-GAT-1 / GABA Transporter 1 / SLC6A1 (N-Terminal Region)"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. GABA transporter 1 (GAT1), also known as sodium- and chloride-dependent GABA transporter 1, is a protein that in humans is encoded by the SLC6A1 gene. GABA Transporter 1 uses Na+ and Cl- to create a gradient, which removes or adds GABA to extracellular spaces in the cerebrum and cerebellum. The stoichiometry for GABA Transporter 1 is 2 Na+: 1 Cl-: 1 GABA. The activity of GAT1 is largely dependent on the presence of Na+, while Cl- assists by increasing the ability for GAT-1 to uptake GABA.
Keywords: Anti-GAT-1, Anti-SLC6A1, Anti-GABATR, Anti-Solute carrier family 6 member 1, Anti-Sodium- and chloride-dependent GABA transporter 1, GAT-1 Antibody / GABA Transporter 1 / SLC6A1 (N-Terminal Region)
Supplier: NSJ Bioreagents
Supplier-Nr: R32967

Properties

Application: WB, IHC (paraffin), IF
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Amino acids 23-54 (ANDKPKTLVVKVQKKAADLPDRDTWKGRFDFL) were used as the immunogen for the GAT-1 antibody.
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-GAT-1 / GABA Transporter 1 / SLC6A1 (N-Terminal Region)"
Write a review
or to review a product.
Viewed