Anti-GAPDH (Glyceraldehyde-3-phosphate Dehydrogenase, Peptidyl-cysteine S-nitrosylase GAPDH, GAPD, C

Anti-GAPDH (Glyceraldehyde-3-phosphate Dehydrogenase, Peptidyl-cysteine S-nitrosylase GAPDH, GAPD, C
Item number Size Datasheet Manual SDS Delivery time Quantity Price
127162.100 100 µg - -

3 - 19 business days*

699.00€
 
Glyceraldehyde 3 phosphate dehydrogenase (GAPDH) is well known as one of the key enzymes involved... more
Product information "Anti-GAPDH (Glyceraldehyde-3-phosphate Dehydrogenase, Peptidyl-cysteine S-nitrosylase GAPDH, GAPD, C"
Glyceraldehyde 3 phosphate dehydrogenase (GAPDH) is well known as one of the key enzymes involved in glycolysis. As well as functioning as a glycolytic enzyme in cytoplasm, recent evidence suggests that mammalian GAPDH is also involved in a great number of intracellular proceses such as membrane fusion, microtubule bundling, phosphotransferase activity, nuclear RNA export, DNA replication, and DNA repair. During the last decade a lot of data appeared concerning the role of GAPDH in different pathologies including prostate cancer progression, programmed neuronal cell death, age related neuronal diseases, such as Alzheimer's and Huntington's disease. GAPDH is expressed in all cells. It is constitutively expressed in almost all tissues at high levels. There are however some physiological factors such as hypoxia and diabetes that increase GAPDH expression in certain cell types. GAPDH molecule is composed of four 36kD subunits. Applications: Suitable for use in ELISA, Immunoprecipitation and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: GKLTGMAFRVPTANVSVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVKLISWYDNEFGYSNRVVDLMAHMASKE, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Supplier: United States Biological
Supplier-Nr: 127162

Properties

Application: ELISA, IP, WB
Antibody Type: Monoclonal
Clone: 1G5
Conjugate: No
Host: Mouse
Species reactivity: human
Immunogen: Partial recombinant corresponding to aa226-335 from human GAPDH (NP_002037) with GST tag. MW of the GST tag alone is 26kD.
Purity: Purified by Protein A affinity chromatography.
Format: Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-GAPDH (Glyceraldehyde-3-phosphate Dehydrogenase, Peptidyl-cysteine S-nitrosylase GAPDH, GAPD, C"
Write a review
or to review a product.
Viewed