Anti-GAL4 / Galectin-4

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
NSJ-R32387	100 µg		-	-	3 - 10 business days*		755.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

0.5mg/ml if reconstituted with 0.2ml sterile DI water. Galectin-4 is a protein that in humans is... more

Close menu

Product information "Anti-GAL4 / Galectin-4"

0.5mg/ml if reconstituted with 0.2ml sterile DI water. Galectin-4 is a protein that in humans is encoded by the LGALS4 gene. This gene is mapped to chromosome 19q13.2 based on an alignment of the LGALS4 sequence. The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. LGALS4 is an S-type lectin that is strongly underexpressed in colorectal cancer. The 323-amino acid LGALS4 protein contains 2 homologous, approximately 150-amino acid carbohydrate recognition domains and all amino acids typically conserved in galectins. Protein function: Galectin that binds lactose and a related range of sugars. May be involved in the assembly of adherens junctions. [The UniProt Consortium]

Keywords:	Anti-Gal-4, Anti-LGALS4, Anti-L36LBP, Anti-Galectin-4, Anti-Antigen NY-CO-27, Anti-Lactose-binding lectin 4, Anti-L-36 lactose-binding protein, GAL4 Antibody / Galectin-4
Supplier:	NSJ Bioreagents
Supplier-Nr:	R32387

Properties

Application:	WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human
Immunogen:	Amino acids DRFKVYANGQHLFDFAHRLSAFQRVDTLEIQGDVTLSY were used as the immunogen for the GAL4 antibody.
Format:	Purified