Anti-GADD45G

Anti-GADD45G
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-RQ4429 100 µg - -

3 - 10 business days*

772.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Growth arrest and DNA-damage-inducible... more
Product information "Anti-GADD45G"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Growth arrest and DNA-damage-inducible protein GADD45 gamma is a protein that in humans is encoded by the GADD45G gene on chromosome 9. This gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The protein encoded by this gene responds to environmental stresses by mediating activation of the p38/JNK pathway via MTK1/MEKK4 kinase. The GADD45G is highly expressed in placenta. Protein function: Involved in the regulation of growth and apoptosis. Mediates activation of stress-responsive MTK1/MEKK4 MAPKKK. [The UniProt Consortium]
Keywords: Anti-CR6, Anti-DDIT-2, Anti-GADD45G, Anti-Cytokine-responsive protein CR6, Anti-DNA damage-inducible transcript 2 protein, Anti-Growth arrest and DNA damage-inducible protein GADD45 gamma, GADD45G Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: RQ4429

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Amino acids MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQ from the human protein were used as the immunogen for the GADD45G antibody.
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-GADD45G"
Write a review
or to review a product.
Viewed