Anti-GADD45G

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
NSJ-RQ4429	100 µg		-	-	3 - 10 business days*		772.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

0.5mg/ml if reconstituted with 0.2ml sterile DI water. Growth arrest and DNA-damage-inducible... more

Close menu

Product information "Anti-GADD45G"

0.5mg/ml if reconstituted with 0.2ml sterile DI water. Growth arrest and DNA-damage-inducible protein GADD45 gamma is a protein that in humans is encoded by the GADD45G gene on chromosome 9. This gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The protein encoded by this gene responds to environmental stresses by mediating activation of the p38/JNK pathway via MTK1/MEKK4 kinase. The GADD45G is highly expressed in placenta. Protein function: Involved in the regulation of growth and apoptosis. Mediates activation of stress-responsive MTK1/MEKK4 MAPKKK. [The UniProt Consortium]

Keywords:	Anti-CR6, Anti-DDIT-2, Anti-GADD45G, Anti-Cytokine-responsive protein CR6, Anti-DNA damage-inducible transcript 2 protein, Anti-Growth arrest and DNA damage-inducible protein GADD45 gamma, GADD45G Antibody
Supplier:	NSJ Bioreagents
Supplier-Nr:	RQ4429

Properties

Application:	WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human, mouse, rat
Immunogen:	Amino acids MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQ from the human protein were used as the immunogen for the GADD45G antibody.
Format:	Purified