Anti-GADD45A

Anti-GADD45A
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32429 100 µg - -

3 - 10 business days*

772.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Growth arrest and DNA-damage-inducible... more
Product information "Anti-GADD45A"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Growth arrest and DNA-damage-inducible protein GADD45 alpha (GADD45A) is a protein that in humans is encoded by the GADD45A gene. This gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. It is located on 1p34-p12. Sequence analysis of human and hamster cDNA clones demonstrated that the gene has been highly conserved and encodes a novel 165-amino acid polypeptide. Northern blot analysis detected moderate expression of a 1.4-kb GADD45A transcript in heart, skeletal muscle, and kidney, with little or no expression in brain, placenta, lung, liver, and pancreas. In addition, Gadd45a promotes epigenetic gene activation by repair-mediated DNA demethylation. Protein function: In T-cells, functions as a regulator of p38 MAPKs by inhibiting p88 phosphorylation and activity. Might affect PCNA interaction with some CDK (cell division protein kinase) complexes, stimulates DNA excision repair in vitro and inhibits entry of cells into S phase. [The UniProt Consortium]
Keywords: Anti-DDIT1, Anti-DDIT-1, Anti-GADD45A, Anti-DNA damage-inducible transcript 1 protein, Anti-Growth arrest and DNA damage-inducible protein GADD45 alpha, GADD45A Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: R32429

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human
Immunogen: Amino acids VLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER were used as the immunogen for the GADD45A antibody.
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: -20°C (International: -20°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-GADD45A"
Write a review
or to review a product.
Viewed