Anti-GADD34 / PPP1R15A

Anti-GADD34 / PPP1R15A
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-RQ7101 100 µg - -

3 - 10 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Protein phosphatase 1 regulatory subunit... more
Product information "Anti-GADD34 / PPP1R15A"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Protein phosphatase 1 regulatory subunit 15A also known as growth arrest and DNA damage-inducible protein GADD34 is a protein that in humans is encoded by the PPP1R15A gene. Protein function: Recruits the serine/threonine-protein phosphatase PPP1CA to prevents excessive phosphorylation of the translation initiation factor eIF-2A/EIF2S1, thereby reversing the shut-off of protein synthesis initiated by stress-inducible kinases and facilitating recovery of cells from stress (PubMed:26742780, PubMed:26095357). Down-regulates the TGF-beta signaling pathway by promoting dephosphorylation of TGFB1 by PP1 (PubMed:14718519). May promote apoptosis by inducing p53/TP53 phosphorylation on 'Ser-15' (PubMed:14635196). Plays an essential role in autophagy by tuning translation during starvation, thus enabling lysosomal biogenesis and a sustained autophagic flux (PubMed:32978159). Acts also a viral restriction factor by attenuating HIV-1 replication (PubMed:31778897). Mechanistically, mediates the inhibition of HIV-1 TAR RNA-mediated translation (PubMed:31778897). [The UniProt Consortium]
Keywords: Anti-GADD34, Anti-PPP1R15A, Anti-Protein phosphatase 1 regulatory subunit 15A, Anti-Growth arrest and DNA damage-inducible protein GADD34, Anti-Myeloid differentiation primary response protein MyD116 homolog, GADD34 Antibody / PPP1R15A
Supplier: NSJ Bioreagents
Supplier-Nr: RQ7101

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human
Immunogen: Amino acids MAPGQAPHQATPWRDAHPFFLLSPVMGLLSRAWSRLR
Format: Ser/Thr Phosphorylation

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-GADD34 / PPP1R15A"
Write a review
or to review a product.
Viewed