Anti-GABARAPL1

Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG41411.50 50 µl - -

6 - 14 business days*

551.00€
 
Protein function: Ubiquitin-like modifier that increases cell-surface expression of kappa-type... more
Product information "Anti-GABARAPL1"
Protein function: Ubiquitin-like modifier that increases cell-surface expression of kappa-type opioid receptor through facilitating anterograde intracellular trafficking of the receptor. Involved in formation of autophagosomal vacuoles. Whereas LC3s are involved in elongation of the phagophore membrane, the GABARAP/GATE-16 subfamily is essential for a later stage in autophagosome maturation (PubMed:16431922, PubMed:20404487). Through its interaction with the reticulophagy receptor TEX264, paticipates in the remodeling of subdomains of the endoplasmic reticulum into autophagosomes upon nutrient stress, which then fuse with lysosomes for endoplasmic reticulum turnover (PubMed:31006538, PubMed:31006537). [The UniProt Consortium]
Keywords: Anti-GEC1, Anti-GEC-1, Anti-GABARAPL1, Anti-Early estrogen-regulated protein, Anti-Glandular epithelial cell protein 1, Anti-GABA(A) receptor-associated protein-like 1, Anti-Gamma-aminobutyric acid receptor-associated protein-like 1
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG41411

Properties

Application: IHC (paraffin), WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human (Expected: mouse, rat, cow, dog, guinea pig, horse, rabbit)
Immunogen: Synthetic peptide around the N-terminal region of Human GABARAPL1. (within the following region: MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYL)
MW: 14 kD
Format: Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-GABARAPL1"
Write a review
or to review a product.
Viewed