Anti-FUT1

Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R31996 100 µg - -

3 - 10 business days*

772.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Galactoside 2-alpha-L-fucosyltransferase 1... more
Product information "Anti-FUT1"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Galactoside 2-alpha-L-fucosyltransferase 1 is an enzyme that in humans is encoded by the FUT1 gene. It is mapped to 19q13.3. The protein encoded by this gene is a Golgi stack membrane protein that is involved in the creation of a precursor of the H antigen, which is required for the final step in the soluble A and B antigen synthesis pathway. This gene is one of two encoding the galactoside 2-L-fucosyltransferase enzyme. Mutations in this gene are a cause of the H-Bombay blood group. Protein function: Creates a soluble precursor oligosaccharide FuC-alpha ((1,2)Galbeta-) called the H antigen which is an essential substrate for the final step in the soluble A and B antigen synthesis pathway. H and Se enzymes fucosylate the same acceptor substrates but exhibit different Km values. [The UniProt Consortium]
Keywords: Anti-H, Anti-FUT1, EC=2.4.1.69, Anti-Alpha(1,2)FT 1, Anti-Fucosyltransferase 1, Anti-Blood group H alpha 2-fucosyltransferase, Anti-Galactoside 2-alpha-L-fucosyltransferase 1, Anti-GDP-L-fucose:beta-D-galactoside 2-alpha-L-fucosyltransferase 1, FUT1 Antib
Supplier: NSJ Bioreagents
Supplier-Nr: R31996

Properties

Application: WB, IHC (paraffin)
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Amino acids EVDSRTPWRELQLHDWMSEEYADLRDPFLKL of human FUT1 were used as the immunogen for the FUT1 antibody.
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: -20°C (International: -20°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-FUT1"
Write a review
or to review a product.
Viewed