Anti-FUS / TLS

Anti-FUS / TLS
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32864 100 µg - -

3 - 10 business days*

772.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. RNA-binding protein FUS/TLS (Fused in... more
Product information "Anti-FUS / TLS"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. RNA-binding protein FUS/TLS (Fused in Sarcoma/Translocated in Sarcoma) is a protein that in humans is encoded by the FUS gene. This gene encodes a multifunctional protein component of the heterogeneous nuclear ribonucleoprotein (hnRNP) complex. The hnRNP complex is involved in pre-mRNA splicing and the export of fully processed mRNA to the cytoplasm. This protein belongs to the FET family of RNA-binding proteins which have been implicated in cellular processes that include regulation of gene expression, maintenance of genomic integrity and mRNA/microRNA processing. Alternative splicing results in multiple transcript variants. Defects in this gene result in amyotrophic lateral sclerosis type 6. Protein function: Binds both single-stranded and double-stranded DNA and promotes ATP-independent annealing of complementary single- stranded DNAs and D-loop formation in superhelical double-stranded DNA. May play a role in maintenance of genomic integrity. [The UniProt Consortium]
Keywords: Anti-TLS, Anti-FUS, Anti-POMp75, Anti-Oncogene FUS, Anti-Oncogene TLS, Anti-RNA-binding protein FUS, Anti-75 kDa DNA-pairing protein, Anti-Translocated in liposarcoma protein, FUS Antibody / TLS
Supplier: NSJ Bioreagents
Supplier-Nr: R32864

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse
Immunogen: Amino acids DNNTIFVQGLGENVTIESVADYFKQIGIIKTNKKT were used as the immunogen for the FUS antibody.
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-FUS / TLS"
Write a review
or to review a product.
Viewed