Anti-FRZB

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG58757.50	50 µl		-	-	10 - 15 business days*		584.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: Soluble frizzled-related proteins (sFRPS) function as modulators of Wnt... more

Close menu

Product information "Anti-FRZB"

Protein function: Soluble frizzled-related proteins (sFRPS) function as modulators of Wnt signaling through direct interaction with Wnts. They have a role in regulating cell growth and differentiation in specific cell types. SFRP3/FRZB appears to be involved in limb skeletogenesis. Antagonist of Wnt8 signaling. Regulates chondrocyte maturation and long bone development. [The UniProt Consortium]

Keywords:	Anti-FIZ, Anti-FRZB, Anti-Fritz, Anti-sFRP-3, Anti-FrzB-1, Anti-Frezzled, Anti-Frizzled-related protein 1, Anti-Secreted frizzled-related protein 3
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG58757

Properties

Application:	IHC (paraffin), WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human (Expected: mouse, rat, bovine, dog, guinea pig, horse, rabbit, zebrafish)
Immunogen:	Synthetic peptide around the middle region of Human FRZB. (within the following sequence: VVEVKEILKSSLVNIPRDTVNLYTSSGCLCPPLNVNEEYIIMGYEDEERS)
MW:	36 kD
Format:	Affinity Purified