Anti-FOXH1 (Forkhead Box Protein H1, Forkhead Activin Signal Transducer 1, Fast-1, hFAST-1, Forkhead

Forkhead box H1 (FOXH1) is a member of the HNF-3FKH family of transcriptional activators. FOXH1 is a winged helix with two loops on the C-terminal side expressed in all human tissue. FOXH1 is an embryonic transcription regulator and is an essential transcriptional co-activator that binds with SMAD2 to activate activin, and therefore induce the gooseciod (GSC) promoter. After FOXH1 binds to SMAD4, activin response element is activated and TGF-b is stimulated. FOXH1 also interacts with NKX2-5 to form an essential component of anterior heart field development. FOXH1 is associated with complex brain malfunctions due to incomplete cleavage of the prosencephalon, and in developmental delays resulting in facial abnormalities such as cyclopia and severe cleft lip or palate. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MGPCSGSRLGPPEAESPSQPPKRRKKRYLRHDKPPYTYLAMIALVIQAAPSRRLKLAQIIRQVQAVFPFFREDYEGWKDSIRHNLSSNRCFRKVPKDPAKPQAKGNFWAVDVSLIPAEALRLQNTALCRRWQNGGARGAFAKDLGPYVLHGRPYRPPSPPPPPSEGFSIKSLLGGSGEGAPWPGLAPQSSPVPAGTGNSGEEAVPTPPLPSSERPLWPLCPLPGPTRVEGETVQGGAIGPSTLSPEPRAWPLHLLQGTAVPGGRSSGGHRASLWGQLPTSYLPIYTPNVVMPLAPPPTSCPQCPSTSPAYWGVAPETRGPPGLLCDLDALFQGVPPNKSIYDVWVSHPRDLAAPGPGWLLSWCSL, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.