Anti-FOXD4L1 (Forkhead Box D4-like 1, FOXD5, bA395L14.1)

Anti-FOXD4L1 (Forkhead Box D4-like 1, FOXD5, bA395L14.1)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
246273.50 50 µg - -

3 - 19 business days*

850.00€
 
This gene is a member of the forkhead/winged-helix (FOX) family of transcription factors with... more
Product information "Anti-FOXD4L1 (Forkhead Box D4-like 1, FOXD5, bA395L14.1)"
This gene is a member of the forkhead/winged-helix (FOX) family of transcription factors with highly conserved FOX DNA-binding domains. Members of the FOX family of transcription factors are regulators of embryogenesis and may play a role in human cancer. This gene lies in a region of chromosome 2 that surrounds the site where two ancestral chromosomes fused to form human chromosome 2. This region is duplicated elsewhere in the human genome, primarily in subtelomeric and pericentromeric locations, thus mutiple copies of this gene have been found. [provided by RefSeq, Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MNLPRAERPRSTPQRSLRDSDGEDGKIDVLGEEEDEDEVEDEEEEASQKFLEQSLQPGLQVARWGGVALPREHIEGGGPSDPSEFGTEFRAPPRSMouse polyclonal antibody raised against a full-length human FOXD4L1 protein.SEDARQPAKPPYSYIALITMAILQSPHKRLTLSGICAFISGRFPYYRRKFPAWQNSIRHNLSLNDCFVKIPREPGHPGKGTYWSLDPASQDMFDNGSFLRRRKRFKRHQLTPGAHLPHPFPLPAAHAALHNPRPGPLLGAPALPQPVPGAYPNTAPGRRPYALLHPHPPRYLLLSAPAYAGAPKKAEGADLATPGTLPVLQPSLGPQPWEEGKGLASPPGGGCISFSIESIMQGVRGAGTGAAQSLSPTAWSYCPLLQRPSSLSDNFAATMouse polyclonal antibody raised against a full-length human FOXD4L1 protein.SGGGLRQRLRSHQGRGAGRAPVGRVGMouse polyclonal antibody raised against a full-length human FOXD4L1 protein.VSGGGRGL, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Supplier: United States Biological
Supplier-Nr: 246273

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Mouse
Species reactivity: human
Immunogen: FOXD4L1 (AAI53202.1, 1aa-408aa) full-length human protein.
Format: Purified

Database Information

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-FOXD4L1 (Forkhead Box D4-like 1, FOXD5, bA395L14.1)"
Write a review
or to review a product.
Viewed