Anti-FMO5

Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG58755.50 50 µl - -

6 - 14 business days*

584.00€
 
Protein function: In contrast with other forms of FMO it does not seem to be a drug-metabolizing... more
Product information "Anti-FMO5"
Protein function: In contrast with other forms of FMO it does not seem to be a drug-metabolizing enzyme. [The UniProt Consortium]
Keywords: Anti-FMO5, Anti-FMO 5, EC=1.14.13.8, Anti-Dimethylaniline oxidase 5, Anti-Hepatic flavin-containing monooxygenase 5, Anti-Dimethylaniline monooxygenase [N-oxide-forming] 5
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG58755

Properties

Application: IHC (paraffin), WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human (Expected: mouse, rat, bovine, dog, guinea pig, horse, rabbit)
Immunogen: Synthetic peptide around the middle region of Human FMO5. (within the following sequence: NKYLEKKINQRFDHEMFGLKPKHRALSQHPTLNDDLPNRIISGLVKVKGN)
MW: 59 kD
Format: Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-FMO5"
Write a review
or to review a product.
Viewed