Anti-FMO3

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG58711.50	50 µg		-	-	6 - 14 business days*		520.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: Essential hepatic enzyme that catalyzes the oxygenation of a wide variety of... more

Close menu

Product information "Anti-FMO3"

Protein function: Essential hepatic enzyme that catalyzes the oxygenation of a wide variety of nitrogen- and sulfur-containing compounds including drugs as well as dietary compounds (PubMed:10759686, PubMed:30381441). Plays an important role in the metabolism of trimethylamine (TMA), via the production of trimethylamine N-oxide (TMAO) metabolite (PubMed:9776311). TMA is generated by the action of gut microbiota using dietary precursors such as choline, choline containing compounds, betaine or L-carnitine. By regulating TMAO concentration, FMO3 directly impacts both platelet responsiveness and rate of thrombus formation (PubMed:29981269). [The UniProt Consortium]

Keywords:	Anti-FMO3, Anti-FMO 3, Anti-FMO II, Anti-FMO form 2, EC=1.14.13.148, Anti-Dimethylaniline oxidase 3, Anti-Trimethylamine monooxygenase, Anti-Hepatic flavin-containing monooxygenase 3, Anti-Dimethylaniline monooxygenase [N-oxide-forming] 3
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG58711

Properties

Application:	WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human, mouse, rat
Immunogen:	Synthetic peptide corresponding to aa. 404-433 of Human FMO3 (DMMNDINEKMEKKRKWFGKSETIQTDYIVY)
MW:	60 kD
Format:	Antigen Affinity Purified