Anti-FMO1

Anti-FMO1
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32180 100 µg - -

7 - 12 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Metabolic N-oxidation of the diet-derived... more
Product information "Anti-FMO1"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Metabolic N-oxidation of the diet-derived amino-trimethylamine (TMA) is mediated by flavin-containing monooxygenase and is subject to an inherited FMO3 polymorphism in man resulting in a small subpopulation with reduced TMA N-oxidation capacity resulting in fish odor syndrome Trimethylaminuria. Three forms of the enzyme, FMO1 found in fetal liver, FMO2 found in adult liver, and FMO3 are encoded by genes clustered in the 1q23-q25 region. Flavin-containing monooxygenases are NADPH-dependent flavoenzymes that catalyzes the oxidation of soft nucleophilic heteroatom centers in drugs, pesticides, and xenobiotics. Several transcript variants encoding different isoforms have been found for this gene. Protein function: This protein is involved in the oxidative metabolism of a variety of xenobiotics such as drugs and pesticides. Form I catalyzes the N-oxygenation of secondary and tertiary amines. [The UniProt Consortium]
Keywords: Anti-FMO1, Anti-FMO 1, EC=1.14.13.8, Anti-Dimethylaniline oxidase 1, Anti-Fetal hepatic flavin-containing monooxygenase 1, Anti-Dimethylaniline monooxygenase [N-oxide-forming] 1, FMO1 Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: R32180

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Amino acids AFPFLDESVVKVEDGQASLYKYIFPAHLQK of human FMO1 were used as the immunogen for the FMO1 antibody.
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: -20°C (International: -20°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-FMO1"
Write a review
or to review a product.
Viewed