Anti-FLT3 Ligand

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG58709.50	50 µg		-	-	6 - 14 business days*		551.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: Stimulates the proliferation of early hematopoietic cells by activating FLT3.... more

Close menu

Product information "Anti-FLT3 Ligand"

Protein function: Stimulates the proliferation of early hematopoietic cells by activating FLT3. Synergizes well with a number of other colony stimulating factors and interleukins. [The UniProt Consortium]

Keywords:	Anti-Flt3L, Anti-FLT3LG, Anti-Flt3 ligand, Anti-SL cytokine, Anti-Fms-related tyrosine kinase 3 ligand
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG58709

Properties

Application:	WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human, rat
Immunogen:	Synthetic peptide corresponding to aa. 79-110 of Human Flt3 Ligand (AQRWMERLKTVAGSKMQGLLERVNTEIHFVTK)
MW:	26 kD
Format:	Antigen Affinity Purified