Anti-FLT3 Ligand

Anti-FLT3 Ligand
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG58709.50 50 µg - -

10 - 15 business days*

551.00€
 
Protein function: Stimulates the proliferation of early hematopoietic cells by activating FLT3.... more
Product information "Anti-FLT3 Ligand"
Protein function: Stimulates the proliferation of early hematopoietic cells by activating FLT3. Synergizes well with a number of other colony stimulating factors and interleukins. [The UniProt Consortium]
Keywords: Anti-Flt3L, Anti-FLT3LG, Anti-Flt3 ligand, Anti-SL cytokine, Anti-Fms-related tyrosine kinase 3 ligand
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG58709

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, rat
Immunogen: Synthetic peptide corresponding to aa. 79-110 of Human Flt3 Ligand (AQRWMERLKTVAGSKMQGLLERVNTEIHFVTK)
MW: 26 kD
Format: Antigen Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-FLT3 Ligand"
Write a review
or to review a product.
Viewed