Anti-FH / Fumarate hydratase, clone 9D8

Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-RQ4634 100 µg - -

3 - 10 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Fumarase (or fumarate hydratase) is an... more
Product information "Anti-FH / Fumarate hydratase, clone 9D8"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Fumarase (or fumarate hydratase) is an enzyme that catalyzes the reversible hydration/dehydration of fumarate to malate. Fumarase comes in two forms: mitochondrial and cytosolic. The mitochondrial isoenzyme is involved in the Krebs Cycle (also known as the Tricarboxylic Acid Cycle [TCA] or the Citric Acid Cycle), and the cytosolic isoenzyme is involved in the metabolism of amino acids and fumarate. Subcellular localization is established by the presence of a signal sequence on the amino terminus in the mitochondrial form, while subcellular localization in the cytosolic form is established by the absence of the signal sequence found in the mitochondrial variety. This enzyme participates in 2 metabolic pathways: citric acid cycle, reductive citric acid cycle (CO2 fixation), and is also important in renal cell carcinoma. Mutations in this gene have been associated with the development of leiomyomas in the skin and uterus in combination with renal cell carcinoma.
Keywords: Anti-FH, Anti-Fumarate hydratase, mitochondrial, FH Antibody / Fumarate hydratase
Supplier: NSJ Bioreagents
Supplier-Nr: RQ4634

Properties

Application: WB, IHC (paraffin)
Antibody Type: Monoclonal
Clone: 9D8
Conjugate: No
Host: Mouse
Species reactivity: human, mouse, rat, monkey
Immunogen: Amino acids YDKAAKIAKTAHKNGSTLKETAIELGYLTAEQFDEWVKPKDMLGPK
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-FH / Fumarate hydratase, clone 9D8"
Write a review
or to review a product.
Viewed