Anti-FGF9

Anti-FGF9
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-RQ4461 100 µg - -

3 - 10 business days*

755.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. FGF 9, Fibroblast growth factor 9, is a... more
Product information "Anti-FGF9"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. FGF 9, Fibroblast growth factor 9, is a protein that in humans is encoded by the FGF9 gene. The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. The FGF 9 gene contains 3 exons. By radioactive chromosomal in situ hybridization, the FGF 9 gene is mapped to chromosome 13q11-q12. This protein was isolated as a secreted factor that exhibits a growth-stimulating effect on cultured glial cells. In nervous system, this protein is produced mainly by neurons and may be important for glial cell development. Expression of the mouse homolog of this gene was found to be dependent on Sonic hedgehog (Shh) signaling. Protein function: Plays an important role in the regulation of embryonic development, cell proliferation, cell differentiation and cell migration. May have a role in glial cell growth and differentiation during development, gliosis during repair and regeneration of brain tissue after damage, differentiation and survival of neuronal cells, and growth stimulation of glial tumors. [The UniProt Consortium]
Keywords: Anti-GAF, Anti-FGF9, Anti-FGF-9, Anti-HBGF-9, Anti-Glia-activating factor, Anti-Fibroblast growth factor 9, Anti-Heparin-binding growth factor 9, FGF9 Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: RQ4461

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Amino acids DHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLY
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-FGF9"
Write a review
or to review a product.
Viewed