Anti-Fetuin-A / AHSG

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
NSJ-R31869	100 µg		-	-	3 - 10 business days*		790.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

0.5mg/ml if reconstituted with 0.2ml sterile DI water. Alpha-2-HS-glycoprotein (AHSG), also known... more

Close menu

Product information "Anti-Fetuin-A / AHSG"

0.5mg/ml if reconstituted with 0.2ml sterile DI water. Alpha-2-HS-glycoprotein (AHSG), also known as Fetuin-A, is a protein that in humans is encoded by the AHSG gene. Fetuin-A belongs to the fetuin class of plasma binding proteins and is more abundant in fetal than adult blood. Its gene is mapped to 3q27. The protein is commonly present in the cortical plate of the immature cerebral cortex and bone marrow hemopoietic matrix. It is involved in several functions, such as endocytosis, brain development and the formation of bone tissue. Protein function: Promotes endocytosis, possesses opsonic properties and influences the mineral phase of bone. Shows affinity for calcium and barium ions. [The UniProt Consortium]

Keywords:	Anti-AHSG, Anti-FETUA, Anti-PRO2743, Fetuin-A Antibody / AHSG
Supplier:	NSJ Bioreagents
Supplier-Nr:	R31869

Properties

Application:	WB, IHC (paraffin), FC, ELISA
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human, rat
Immunogen:	Amino acids DDPETEEAALVAIDYINQNLPWGYKHTLNQIDE of human AHSG were used as the immunogen for the AHSG antibody.
Format:	Purified