Anti-FECH

Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG58616.50 50 µl - -

6 - 14 business days*

584.00€
 
Protein function: Catalyzes the ferrous insertion into protoporphyrin IX. [The UniProt Consortium] more
Product information "Anti-FECH"
Protein function: Catalyzes the ferrous insertion into protoporphyrin IX. [The UniProt Consortium]
Keywords: Anti-FECH, EC=4.99.1.1, Anti-Heme synthase, Anti-Protoheme ferro-lyase, Anti-Ferrochelatase, mitochondrial
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG58616

Properties

Application: ICC, IF, WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse (Expected: bovine, rat, dog, guinea pig, horse, rabbit, yeast, zebrafish)
Immunogen: Synthetic peptide around the N-terminal region of Human FECH. (within the following sequence: LDRDLMTLPIQNKLAPFIAKRRTPKIQEQYRRIGGGSPIKIWTSKQGEGM)
MW: 47 kD
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-FECH"
Write a review
or to review a product.
Viewed