Anti-FDCSP

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
NSJ-R32777	100 µg		-	-	7 - 12 business days*		790.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

0.5mg/ml if reconstituted with 0.2ml sterile DI water. FDC-SP or follicular dendritic... more

Close menu

Product information "Anti-FDCSP"

0.5mg/ml if reconstituted with 0.2ml sterile DI water. FDC-SP or follicular dendritic cell-secreted protein, is a small, secreted protein, located on chromosome 4 in humans. FDC-SP is a 68-amino acid protein containing a signal peptide at its N terminus, which is used for directing the transport of the protein. This protein specifically binds to activated B cells, and functions as a regulator of antibody responses. It is also thought to contribute to tumor metastases by promoting cancer cell migration and invasion. Protein function: Can bind to the surface of B-lymphoma cells, but not T- lymphoma cells, consistent with a function as a secreted mediator acting upon B-cells. [The UniProt Consortium]

Keywords:	Anti-FDCSP, Anti-FDC-SP, Anti-C4orf7, Anti-FDC secreted protein, Anti-Follicular dendritic cell secreted peptide, FDCSP Antibody
Supplier:	NSJ Bioreagents
Supplier-Nr:	R32777

Properties

Application:	IHC (paraffin), IF
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human
Immunogen:	Amino acids 18-51 (FPVSQDQEREKRSISDSDELASGFFVFPYPYPFR) from the human protein
Format:	Purified