Anti-FDCSP

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG59445.50	50 µg		-	-	10 - 15 business days*		551.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: Can bind to the surface of B-lymphoma cells, but not T- lymphoma cells,... more

Close menu

Product information "Anti-FDCSP"

Protein function: Can bind to the surface of B-lymphoma cells, but not T- lymphoma cells, consistent with a function as a secreted mediator acting upon B-cells. [The UniProt Consortium]

Keywords:	Anti-FDCSP, Anti-C4orf7, Anti-FDC-SP, Anti-FDC secreted protein, Anti-Follicular dendritic cell secreted peptide
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG59445

Properties

Application:	IHC (paraffin)
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human
Immunogen:	Synthetic peptide corresponding to aa. 18-51 of Human FDCSP. (FPVSQDQEREKRSISDSDELASGFFVFPYPYPFR)
MW:	10 kD
Format:	Antigen Affinity Purified