Anti-FAU

Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG58615.50 50 µl - -

10 - 15 business days*

584.00€
 
Product information "Anti-FAU"
Keywords: Anti-FAU, Anti-Ubiquitin-like protein FUBI
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG58615

Properties

Application: IHC (paraffin), WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human (Expected: mouse, rat, bovine, dog, guinea pig, horse, rabbit, zebrafish)
Immunogen: Synthetic peptide around the middle region of Human FAU. (within the following sequence: VRGQTPKVAKQEKKKKKTGRAKRRMQYNRRFVNVVPTFGKKKGPNANS)
MW: 14 kD
Format: Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-FAU"
Write a review
or to review a product.
Viewed