Anti-FAM164A (ZC2HC1A, C8orf70, Zinc Finger C2HC Domain-containing Protein 1A, CGI-62)

Anti-FAM164A (ZC2HC1A, C8orf70, Zinc Finger C2HC Domain-containing Protein 1A, CGI-62)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
124162.50 50 µg - -

3 - 19 business days*

699.00€
 
Applications:|Suitable for use in Immunofluorescence and Western Blot. Other applications not... more
Product information "Anti-FAM164A (ZC2HC1A, C8orf70, Zinc Finger C2HC Domain-containing Protein 1A, CGI-62)"
Applications:, Suitable for use in Immunofluorescence and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml, Optimal dilutions to be determined by the researcher. AA Sequence: MEGLEENGGVVQVGELLPCKICGRTFFPVALKKHGPICQKTATKKRKTFDSSRQRAEGTDIPTVKPLKPRPEPPKKPSNWRRKHEEFIATIRAAKGLDQALKEGGKLPPPPPPSYDPDYIQCPYCQRRFNENAADRHINFCKEQAARISNKGKFSTDTKGKPTSRTQVYKPPALKKSNSPGTASSGSSRLPQPSGAGKTVVGVPSGKVSSSSSSLGNKLQTLSPSHKGIAAPHAGANVKPRNSTPPSLARNPAPGVLTNKRKTYTESYIARPDGDCASSLNGGNIKGIEGHSPGNLPKFCHECGTKYPVEWAKFCCECGIRRMIL, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Keywords: Anti-CGI-62, Anti-C8orf70, Anti-ZC2HC1A, Anti-Zinc finger C2HC domain-containing protein 1A
Supplier: United States Biological
Supplier-Nr: 124162

Properties

Application: IF, WB
Antibody Type: Polyclonal
Conjugate: No
Host: Mouse
Species reactivity: human
Immunogen: Full length human C8orf70
Format: Affinity Purified

Database Information

UniProt ID : Q96GY0 | Matching products
Gene ID GeneID 51101 | Matching products

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-FAM164A (ZC2HC1A, C8orf70, Zinc Finger C2HC Domain-containing Protein 1A, CGI-62)"
Write a review
or to review a product.
Viewed