Anti-FABP4

Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R31970 100 µg - -

3 - 10 business days*

772.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Fatty acid binding proteins (FABPs) are... more
Product information "Anti-FABP4"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Fatty acid binding proteins (FABPs) are small cytoplasmic proteins that are expressed in a highly tissue-specific manner and bind to fatty acids such as oleic and retinoic acid. Adipocyte fatty-acid-binding protein, aP2 (FABP4) is expressed in adipocytes and macrophages, and integrates inflammatory and metabolic responses. Studies in aP2-deficient mice have shown that this lipid chaperone has a significant role in several aspects of metabolic syndrome, including type 2 diabetes and atherosclerosis. It regulates allergic airway inflammation and may provide a link between fatty acid metabolism and asthma. Protein function: Lipid transport protein in adipocytes. Binds both long chain fatty acids and retinoic acid. Delivers long-chain fatty acids and retinoic acid to their cognate receptors in the nucleus. [The UniProt Consortium]
Keywords: Anti-ALBP, Anti-AFABP, Anti-FABP4, Anti-A-FABP, Anti-Fatty acid-binding protein 4, Anti-Adipocyte lipid-binding protein, Anti-Fatty acid-binding protein, adipocyte, Anti-Adipocyte-type fatty acid-binding protein, FABP4 Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: R31970

Properties

Application: WB, IHC (paraffin)
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Amino acids KLVSSENFDDYMKEVGVGFATRKVAGMAKPN of human FABP4
Format: Metabolism

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-FABP4"
Write a review
or to review a product.
Viewed