Anti-FABP2 (intestinal)

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
NSJ-R32378	100 µg		-	-	3 - 10 business days*		790.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

0.5mg/ml if reconstituted with 0.2ml sterile DI water. FABP are thought to play a role in the... more

Close menu

Product information "Anti-FABP2 (intestinal)"

0.5mg/ml if reconstituted with 0.2ml sterile DI water. FABP are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters. FABP2 is probably involved in triglyceride-rich lipoprotein synthesis. Binds saturated long-chain fatty acids with a high affinity, but binds with a lower affinity to unsaturated long-chain fatty acids. FABP2 may also help maintain energy homeostasis by functioning as a lipid sensor. [UniProt] Protein function: FABP are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters. FABP2 is probably involved in triglyceride-rich lipoprotein synthesis. Binds saturated long-chain fatty acids with a high affinity, but binds with a lower affinity to unsaturated long- chain fatty acids. FABP2 may also help maintain energy homeostasis by functioning as a lipid sensor. [The UniProt Consortium]

Keywords:	Anti-FABPI, Anti-FABP2, Anti-I-FABP, Anti-Fatty acid-binding protein 2, Anti-Fatty acid-binding protein, intestinal, Anti-Intestinal-type fatty acid-binding protein, FABP2 Antibody (intestinal)
Supplier:	NSJ Bioreagents
Supplier-Nr:	R32378

Properties

Application:	WB, IHC (paraffin)
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human, mouse, rat
Immunogen:	Amino acids AFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLK from the human protein were used as the immunogen for the FABP2 antibody.
Format:	Purified