Anti-EYA1

Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG58944.50 50 µl - -

10 - 15 business days*

584.00€
 
Protein function: Functions both as protein phosphatase and as transcriptional coactivator for... more
Product information "Anti-EYA1"
Protein function: Functions both as protein phosphatase and as transcriptional coactivator for SIX1, and probably also for SIX2, SIX4 and SIX5. Tyrosine phosphatase that dephosphorylates 'Tyr-142' of histone H2AX (H2AXY142ph) and promotes efficient DNA repair via the recruitment of DNA repair complexes containing MDC1. 'Tyr-142' phosphorylation of histone H2AX plays a central role in DNA repair and acts as a mark that distinguishes between apoptotic and repair responses to genotoxic stress (PubMed:19234442). Its function as histone phosphatase may contribute to its function in transcription regulation during organogenesis. Has also phosphatase activity with proteins phosphorylated on Ser and Thr residues (in vitro). Required for normal embryonic development of the craniofacial and trunk skeleton, kidneys and ears. Together with SIX1, it plays an important role in hypaxial muscle development, in this it is functionally redundant with EYA2. [The UniProt Consortium]
Keywords: Anti-EYA1, Anti-Eyes absent homolog 1
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG58944

Properties

Application: IHC (paraffin), WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human (Expected: mouse, rat, bovine, dog, guinea pig, horse, rabbit, zebrafish)
Immunogen: Synthetic peptide around the middle region of Human EYA1. (within the following region: QDYPSYPSFGQGQYAQYYNSSPYPAHYMTSSNTSPTTPSTNATYQLQEPP)
Format: Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-EYA1"
Write a review
or to review a product.
Viewed