Anti-EXOSC3 (exosome Component 3, CGI-102, MGC15120, MGC723, RP11-3J10.8, RRP40, Rrp40p, bA3J10.7, h

Anti-EXOSC3 (exosome Component 3, CGI-102, MGC15120, MGC723, RP11-3J10.8, RRP40, Rrp40p, bA3J10.7, h
Item number Size Datasheet Manual SDS Delivery time Quantity Price
245865.100 100 µg - -

3 - 19 business days*

850.00€
 
Mouse monoclonal antibody raised against a partial recombinant EXOSC3.||Applications: |Suitable... more
Product information "Anti-EXOSC3 (exosome Component 3, CGI-102, MGC15120, MGC723, RP11-3J10.8, RRP40, Rrp40p, bA3J10.7, h"
Mouse monoclonal antibody raised against a partial recombinant EXOSC3. Applications: Suitable for use in Immunoprecipitation. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: PEMVCIDSCGRANGMGVIGQDGLLFKVTLGLIRKLLAPDCEIIQEVGKLYPLEIVFGMNGRIWVKAKTIQQTLILANILEACEHMTSDQRKQIFSRLAE, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Supplier: United States Biological
Supplier-Nr: 245865

Properties

Application: ELISA, IP
Antibody Type: Monoclonal
Clone: 300000
Conjugate: No
Host: Mouse
Species reactivity: human
Immunogen: EXOSC3 (NP_057126.2, 176aa-274aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Format: Purified

Database Information

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-EXOSC3 (exosome Component 3, CGI-102, MGC15120, MGC723, RP11-3J10.8, RRP40, Rrp40p, bA3J10.7, h"
Write a review
or to review a product.
Viewed