Anti-EWSR1 / EWS

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG43229.50	50 µg		-	-	6 - 14 business days*		551.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: Might normally function as a transcriptional repressor. EWS- fusion-proteins... more

Close menu

Product information "Anti-EWSR1 / EWS"

Protein function: Might normally function as a transcriptional repressor. EWS- fusion-proteins (EFPS) may play a role in the tumorigenic process. They may disturb gene expression by mimicking, or interfering with the normal function of CTD-POLII within the transcription initiation complex. They may also contribute to an aberrant activation of the fusion protein target genes. [The UniProt Consortium]

Keywords:	Anti-EWS, Anti-EWSR1, Anti-EWS oncogene, Anti-EWS oncogene, Anti-RNA-binding protein EWS, Anti-RNA-binding protein EWS, Anti-Ewing sarcoma breakpoint region 1 protein, Anti-Ewing sarcoma breakpoint region 1 protein
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG43229

Properties

Application:	FC, ICC, IF, IHC (frozen), IHC (paraffin), WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human, mouse, rat
Immunogen:	Synthetic peptide corresponding to aa. 369-399 of Human EWSR1 / EWS. (NDSVTLDDLADFFKQCGVVKMNKRTGQPMIH)
MW:	68 kD
Format:	Antigen Affinity Purified