Anti-ERp57 / PDIA3

Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32052 100 µg - -

3 - 10 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. PDIA3 (Protein disulfide isomerase family... more
Product information "Anti-ERp57 / PDIA3"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. PDIA3 (Protein disulfide isomerase family A, member 3), also called GRP58, Erp57 or ER60, is an isomerase enzyme. It is mapped on 15q15.3. PDIA3 is also part of the major histocompatibility complex (MHC) class I peptide-loading complex, which is essential for formation of the final antigen conformation and export from the endoplasmic reticulum to the cell surface. This gene encodes a protein of the endoplasmic reticulum that interacts with lectin chaperones calreticulin and calnexin to modulate folding of newly synthesized glycoproteins. The protein was once thought to be a phospholipase, however, it has been demonstrated that the protein actually has protein disulfide isomerase activity. It is thought that complexes of lectins and this protein mediate protein folding by promoting formation of disulfide bonds in their glycoprotein substrates.
Keywords: Anti-p58, Anti-PDIA3, Anti-ERp57, Anti-ERp60, Anti-ERP57, EC=5.3.4.1, Anti-ER protein 60, Anti-ER protein 57, Anti-Disulfide isomerase ER-60, Anti-58 kDa microsomal protein, Anti-Protein disulfide-isomerase A3, Anti-58 kDa glucose-regulated protein, ERp57
Supplier: NSJ Bioreagents
Supplier-Nr: R32052

Properties

Application: WB, IHC (paraffin), IHC (frozen)
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Amino acids RELSDFISYLQREATNPPVIQEEKPKKKKKAQEDL of human PDIA3/ERp57 were used as the immunogen for the PDIA3 antibody.
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: -20°C (International: -20°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-ERp57 / PDIA3"
Write a review
or to review a product.
Viewed