Anti-Eph Receptor B1 / EphB1

Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32141 100 µg - -

3 - 10 business days*

772.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Ephrin type-B receptor 1 is a protein that... more
Product information "Anti-Eph Receptor B1 / EphB1"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Ephrin type-B receptor 1 is a protein that in humans is encoded by the EPHB1 gene. Ephrin receptors and their ligands, the ephrins, mediate numerous developmental processes, particularly in the nervous system. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. The Eph family of receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. Ephrin receptors make up the largest subgroup of the receptor tyrosine kinase (RTK) family. The protein encoded by this gene is a receptor for ephrin-B family members. Protein function: Receptor tyrosine kinase which binds promiscuously transmembrane ephrin-B family ligands residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. Cognate/functional ephrin ligands for this receptor include EFNB1, EFNB2 and EFNB3. During nervous system development, regulates retinal axon guidance redirecting ipsilaterally ventrotemporal retinal ganglion cells axons at the optic chiasm midline. This probably requires repulsive interaction with EFNB2. In the adult nervous system together with EFNB3, regulates chemotaxis, proliferation and polarity of the hippocampus neural progenitors. In addition to its role in axon guidance also plays an important redundant role with other ephrin-B receptors in development and maturation of dendritic spines and synapse formation. May also regulate angiogenesis. More generally, may play a role in targeted cell migration and adhesion. Upon activation by EFNB1 and probably other ephrin-B ligands activates the MAPK/ERK and the JNK signaling cascades to regulate cell migration and adhesion respectively. Involved in the maintenance of the pool of satellite cells (muscle stem cells) by promoting their self-renewal and reducing their activation and differentiation. [The UniProt Consortium]
Keywords: Anti-NET, Anti-EK6, Anti-ELK, Anti-hEK6, Anti-EPHB1, EC=2.7.10.1, Anti-EPH-like kinase 6, Anti-EPH tyrosine kinase 2, Anti-Ephrin type-B receptor 1, Anti-Tyrosine-protein kinase receptor EPH-2, Anti-Neuronally-expressed EPH-related tyrosine kinase, Eph Re
Supplier: NSJ Bioreagents
Supplier-Nr: R32141

Properties

Application: WB, IHC (paraffin), FC
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Amino acids RTYQVCNVFEPNQNNWLLTTFINRRGAHRIYTE of human Eph receptor B1
Format: Tyrosine Phosphorylation

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-Eph Receptor B1 / EphB1"
Write a review
or to review a product.
Viewed