Anti-Emerin, clone 5A10

Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG58577.50 50 µg - -

10 - 15 business days*

551.00€
 
Protein function: Stabilizes and promotes the formation of a nuclear actin cortical network.... more
Product information "Anti-Emerin, clone 5A10"
Protein function: Stabilizes and promotes the formation of a nuclear actin cortical network. Stimulates actin polymerization in vitro by binding and stabilizing the pointed end of growing filaments. Inhibits beta-catenin activity by preventing its accumulation in the nucleus. Acts by influencing the nuclear accumulation of beta- catenin through a CRM1-dependent export pathway. Links centrosomes to the nuclear envelope via a microtubule association. EMD and BAF are cooperative cofactors of HIV-1 infection. Association of EMD with the viral DNA requires the presence of BAF and viral integrase. The association of viral DNA with chromatin requires the presence of BAF and EMD. Required for proper localization of non-farnesylated prelamin-A/C. [The UniProt Consortium]
Keywords: Anti-EMD, Anti-EDMD, Anti-Emerin
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG58577

Properties

Application: IHC (paraffin), WB
Antibody Type: Monoclonal
Clone: 5A10
Conjugate: No
Host: Mouse
Species reactivity: human
Immunogen: Synthetic peptide corresponding to aa. 1-48 of Human Emerin. (MDNYADLSDTELTTLLRRYNIPHGPVVGSTRRLYEKKIFEYETQRRRL)
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-Emerin, clone 5A10"
Write a review
or to review a product.
Viewed