Anti-ELF1 / E74 like factor 1

Anti-ELF1 / E74 like factor 1
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-RQ4212 100 µg - -

3 - 10 business days*

755.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. E74-like factor 1 (ets domain... more
Product information "Anti-ELF1 / E74 like factor 1"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. E74-like factor 1 (ets domain transcription factor) is a protein that in humans is encoded by the ELF1 gene. It is mapped to chromosome 13q13. This gene encodes an E26 transformation-specific related transcription factor. The encoded protein is primarily expressed in lymphoid cells and acts as both an enhancer and a repressor to regulate transcription of various genes. Alternative splicing results in multiple transcript variants. Protein function: Transcription factor that activates the LYN and BLK promoters. Appears to be required for the T-cell-receptor-mediated trans activation of HIV-2 gene expression. Binds specifically to two purine-rich motifs in the HIV-2 enhancer. [The UniProt Consortium]
Keywords: Anti-ELF1, Anti-E74-like factor 1, Anti-ETS-related transcription factor Elf-1, ELF1 Antibody / E74 like factor 1
Supplier: NSJ Bioreagents
Supplier-Nr: RQ4212

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human
Immunogen: Amino acids QPTQSPYPTQLFRTVHVVQPVQAVPEGEAARTSTMQDE were used as the immunogen for the Elf-1 antibody.
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-ELF1 / E74 like factor 1"
Write a review
or to review a product.
Viewed