Anti-ELANE (Neutrophil Elastase, Bone Marrow Serine Protease, Elastase-2, Human Leukocyte Elastase,

Anti-ELANE (Neutrophil Elastase, Bone Marrow Serine Protease, Elastase-2, Human Leukocyte Elastase,
Item number Size Datasheet Manual SDS Delivery time Quantity Price
126268.50 50 µg - -

5 - 10 business days*

850.00€
 
Modifies the functions of natural killer cells, monocytes and granulocytes. Inhibits... more
Product information "Anti-ELANE (Neutrophil Elastase, Bone Marrow Serine Protease, Elastase-2, Human Leukocyte Elastase,"
Modifies the functions of natural killer cells, monocytes and granulocytes. Inhibits C5a-dependent neutrophil enzyme release and chemotaxis. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml, Optimal dilutions to be determined by the researcher. AA Sequence: VLQELNVTVVTSLCRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVNWIDSIIQRSEDNPCPHPRDPDPASRTH, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Supplier: United States Biological
Supplier-Nr: 126268

Properties

Application: ELISA, IF, WB
Antibody Type: Monoclonal
Clone: 4E11
Conjugate: No
Host: Mouse
Species reactivity: human
Format: Affinity Purified

Database Information

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-ELANE (Neutrophil Elastase, Bone Marrow Serine Protease, Elastase-2, Human Leukocyte Elastase,"
Write a review
or to review a product.
Viewed