Anti-E2F4

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG58513.50	50 µg		-	-	6 - 14 business days*		508.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: Transcription activator that binds DNA cooperatively with DP proteins through... more

Close menu

Product information "Anti-E2F4"

Protein function: Transcription activator that binds DNA cooperatively with DP proteins through the E2 recognition site, 5'-TTTC[CG]CGC- 3' found in the promoter region of a number of genes whose products are involved in cell cycle regulation or in DNA replication. The DRTF1/E2F complex functions in the control of cell-cycle progression from G1 to S phase. E2F4 binds with high affinity to RBL1 and RBL2. In some instances can also bind RB1. Specifically required for multiciliate cell differentiation: together with MCIDAS and E2F5, binds and activate genes required for centriole biogenesis. [The UniProt Consortium]

Keywords:	Anti-E2F4, Anti-E2F-4, Anti-Transcription factor E2F4
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG58513

Properties

Application:	IHC (paraffin), WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human, mouse, rat
Immunogen:	Synthetic peptide corresponding to a sequence at the N-terminus of Human E2F4 (106-144aa ELQQREQELDQHKVWVQQSIRNVTEDVQNSCLAYVTHED), identical to the related Mouse and Rat sequences
MW:	44 kD
Format:	Antigen Affinity Purified