Anti-E2F4

Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG58513.50 50 µg - -

6 - 14 business days*

538.00€
 
Protein function: Transcription activator that binds DNA cooperatively with DP proteins through... more
Product information "Anti-E2F4"
Protein function: Transcription activator that binds DNA cooperatively with DP proteins through the E2 recognition site, 5'-TTTC[CG]CGC- 3' found in the promoter region of a number of genes whose products are involved in cell cycle regulation or in DNA replication. The DRTF1/E2F complex functions in the control of cell-cycle progression from G1 to S phase. E2F4 binds with high affinity to RBL1 and RBL2. In some instances can also bind RB1. Specifically required for multiciliate cell differentiation: together with MCIDAS and E2F5, binds and activate genes required for centriole biogenesis. [The UniProt Consortium]
Keywords: Anti-E2F4, Anti-E2F-4, Anti-Transcription factor E2F4
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG58513

Properties

Application: IHC (paraffin), WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Synthetic peptide corresponding to a sequence at the N-terminus of Human E2F4 (106-144aa ELQQREQELDQHKVWVQQSIRNVTEDVQNSCLAYVTHED), identical to the related Mouse and Rat sequences
MW: 44 kD
Format: Antigen Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-E2F4"
Write a review
or to review a product.
Viewed